The largest database of trusted experimental protocols

D glucose g8270

Manufactured by Merck Group
Sourced in United States

D-glucose (G8270) is a chemical compound that serves as a common carbohydrate and the primary source of energy for many living organisms. It is a simple sugar that can be readily metabolized by cells to produce ATP, the primary energy currency of the cell. This product is suitable for use in various laboratory applications, including cell culture, enzymatic assays, and metabolic studies.

Automatically generated - may contain errors

11 protocols using d glucose g8270

1

Native Cultivation Using D(+)-Glucose

Check if the same lab product or an alternative is used in the 5 most similar protocols
For native cultivations, the protocol described in Section 2.2.1 was applied using D(+)-glucose (G8270 ≥ 99.5%) obtained from Sigma-Aldrich (St. Louis, MA, USA) as a sole carbon source.
+ Open protocol
+ Expand
2

Synthesis and Characterization of GLP-1 Peptides

Check if the same lab product or an alternative is used in the 5 most similar protocols
Ex-9 and Ex-4 was synthesized by Genomics BioSci & Technology (Taipei, Taiwan). [Aib8] GLP-1 (7–36) amide is the DPP4-resistant GLP-1 peptide (termed GLP-1′) with the sequence HAibEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (where Aib stands for aminoisobutyric acid)10 (link), and the [Aib8, E22, E30]-GLP-1(7–36) amide is the DPP4-resistant GLP-1 mutant peptide with the sequence HAibEGTFTSDVSSYLEEQAAKEFIEWLVKGR-NH2. Both of the two amides were synthesized by LifeTein (New Jersey, USA). Isotonic sodium chloride solution (0.9% sodium chloride) was purchased from Sintong Taiwan Biotech (Taoyuan, Taiwan). The RPMI-1640 tissue culture medium, minimum essential medium (MEM), phenol red-free MEM, HEPES, sodium pyruvate, fetal bovine serum (FBS), penicillin-streptomycin, L-glutamine, amphotericin B, gentamicin, and 0.05% trypsin-EDTA were purchased from Life Technologies (Carlsbad, CA, USA). Puromycin, G418 and D-(+)-glucose (G8270) were purchased from Sigma-Aldrich (St. Louis, MO, USA). Coelenterazine 400 a (DeepBlueC, C-320–1) was purchased from Gold Biotechnology (St. Louis, MO, USA). N55 was obtained as described previously8 (link).
+ Open protocol
+ Expand
3

Glucose and Insulin Tolerance Tests

Check if the same lab product or an alternative is used in the 5 most similar protocols
Mice were fasted for either 16 h (before the glucose tolerance test, GTT) or 6 h (before the insulin tolerance test, ITT) with water supplied in a new cage. After fasting, BWs and initial glucose levels were recorded using a scale and glucometer (One touch ultra, Johnson and Johnson, New Brunswick, NJ), respectively. After these initial measurements, 2‐g/kg D‐glucose (G8270, Sigma‐Aldrich) in PBS (for GTT) or 0.5‐U/kg recombinant insulin (91077C, Sigma‐Aldrich) in PBS (for ITT) were injected intraperitoneally (n = 10). Blood glucose levels were measured from the tail vein at time 0 and then every 30, 60 and 120 min after the injection.
+ Open protocol
+ Expand
4

Antioxidant Potential of LPF Peptide

Check if the same lab product or an alternative is used in the 5 most similar protocols
LPF peptide was synthesized by Genscript Biotech Corporation (Nanjing, China). D-glucose (G8270) and MTT (M2003) were purchased from Sigma. 2,2′-Azobis(2-methylpropionamidine) dihydrochloride (AAPH, A101386) was from Aladdin Biochemical Technology (Shanghai, China). Sodium fluorescein and 6-hydroxy-2,5,7,8-tetramethylchroman-2-carboxylic acid (Trolox) were from Wako Pure Chemical (Osaka, Japan). Anti-O-GlcNAc antibody (CTD110.6) (sc-59623) was from Santa Cruz Biotechnology. Lipid Peroxidation Assay Kit (S0131S), Glutathione (GSH) Assay Kit (S0052), Hematoxylin and Eosin Staining Kit (C0105S), DAPI (C1002), and H2DCFDA (S0033S) were purchased from Beyotime Biotechnology (Shanghai, China). Anti-Pax3 antibody was from DSHB. Primary antibodies, anti-NRF2 and anti-Keap1, were purchased from Proteintech. Anti-β-Actin and HRP-conjugated secondary anti-rabbit and anti-mouse antibodies were purchased from Fude Biological Technology (Hangzhou, China). Alexa Fluor 488 goat anti-rabbit IgG was purchased from Invitrogen (Carlsbad, CA, USA).
+ Open protocol
+ Expand
5

Stem Cell Culture Optimization with Supplements

Check if the same lab product or an alternative is used in the 5 most similar protocols
N2 Supplement, 100x concentrate (17502-048), B27 media Supplement, 50x concentrate (17504-044) and GlutaMax Supplement 100x concentrate (35050-038) were acquired from Invitrogen (GE Healthcare, Ireland). Recombinant murine EGF (epidermal growth factor) (315-09), recombinant human R-spondin-1 (120-38) and recombinant murine Noggin (250-38) were from Peprotech (NJ, USA). Matrigel® with reduced growth factors (356231) was from Corning (VWR, Ireland). Penicillin-streptomycin solution (P0781), N-Acetyl-l-cysteine (NAC, A9165), Dulbecco's modified Eagle's medium nutrient mixture F-12 [HAM] (D6421), Dulbecco's modified Eagle's medium (DMEM), phenol red-, glucose-, pyruvate- and glutamine-free (D5030), d(+)-Glucose (G8270), 1 M HEPES solution pH 7.2 (H0887), 100 mM sodium pyruvate (S8636), 200 mM l-Glutamine (G7513), CHIR99021 (SML1046) and sodium valproate (P4543) and all the other reagents were from Sigma-Aldrich (Dublin, Ireland). Phosphorescent O2-sensitive Pt-Glc probe was synthesized as described previously [17 ]. Seahorse XF96 plates were from Agilent® technologies (Little Island, Cork, Ireland).
+ Open protocol
+ Expand
6

Glucose Tolerance Test in Mice

Check if the same lab product or an alternative is used in the 5 most similar protocols
Glucose tolerance was assessed in mice using an IPGTT, which was performed by injecting 1.5 g/kg D-glucose (G8270, Sigma-Aldrich, MO, USA) intraperitoneally into overnight-fasted mice. Tail blood was collected before and 0, 15, 30, 60, 90, and 120 min after glucose administration. Blood glucose concentrations were measured using an Accu-Check glucose analyzer (Roche Diagnostics Ltd., Mannheim, Germany). Body weights, fasting glucose levels, and area under the IPGTT curve were analyzed using two-sample t-test. Data are presented as means ± standard errors of means, and statistical significance was accepted for P values <0.05.
+ Open protocol
+ Expand
7

Fetal Bovine Serum and DMEM in Cell Culture

Check if the same lab product or an alternative is used in the 5 most similar protocols
Fetal bovine serum (FBS), Dulbecco's modified Eagle's medium (DMEM), and trypsin were purchased from Gibco Life Technologies (Grand Island, NY, USA). D-Glucose (G8270) and N-acetyl cysteine (NAC; A7250) were purchased from Sigma Chemical (St. Louis, MO, USA). The JNK inhibitor SP600125 was purchased from Selleck Chemicals (s1460; Houston, TX, USA). The antibodies used in this study were against CDK2 (ab32147), active caspase-3 (ab2302), and Ki-67 (ab16667; Abcam Inc., MA, USA) and GAPDH (5174S), JNK (9252T), phospho-JNK (4668T), c-Jun (9165P), phospho-c-Jun (3270P), cyclin D1 (2978), p21 (2947), Bax (2772S), and Bcl-2 (15071S; Cell Signaling Technology Inc., MA, USA).
+ Open protocol
+ Expand
8

Metabolic Activation of Bone Marrow Macrophages

Check if the same lab product or an alternative is used in the 5 most similar protocols
Bone marrow cells were isolated from femurs of 3–6 months old male TG2 null mice and their wild type counterparts. Bone marrow macrophages (BMDMs) were differentiated in DMEM supplemented with 10% FBS (12106C), 2 mM L-glutamine (G7513), 1 mM Na-pyruvate (S8636), 50 μM 2-mercaptoethanol (M3148) and 100 U/ml penicillin/100 μg/ml streptomycin (P4333) all from Sigma-Aldrich and 10% L929 fibroblast conditioned media for 7 days. For metabolic activation, differentiated macrophages were treated with a combination of 30 mM D-glucose (G8270), 10 nM insulin (12643) and 0.4 mM sodium-palmitate (P9767) all from Sigma-Aldrich for 24 h (16). Sodium palmitate was prepared by diluting a 200 mM stock solution in 70% ethanol into 10% fatty acid-free, low-endotoxin BSA (Sigma Aldrich, A8806 adjusted to pH 7.4) to obtain a 5 mM palmitate-BSA stock solution that was filtered using a 0.22-μm low-protein binding filter (Millipore). BSA/ethanol was used in control treatments during the protocol. In some experiments during the 24 h metabolic activation BMDMs were treated with PP2 (Sigma Aldrich, 529573), a reversible ATP-competitive inhibitor of the Src family of protein tyrosine kinases, in 2 µM final concentration or 0.5 mg/ml RGD peptide (Cayman Chemical, 529573).
+ Open protocol
+ Expand
9

Streptozocin-Induced Glucose Metabolism Regulation

Check if the same lab product or an alternative is used in the 5 most similar protocols
Streptozocin (S0130) and D‐glucose (G8270) were obtained from Sigma‐Aldrich Chemical Company (Sigma). BBR (BWC9020‐2016) was procured from BeNa Biotechnology. Membrane and cytosolic protein extraction kits (P0033), trypan blue (ST798), EdU (5‐ethynyl‐2′‐deoxyuridine) assays (C0071S) and cell cycle detection kits (BB‐4104) were acquired from Beyotime Biotechnology. The 2‐NBDG (2‐deoxy‐2‐ [(7‐nitro‐2,1,3‐benzoxadiazol‐4‐yl) amino]‐D‐glucose) assay (N13195) was obtained from Thermo Fisher Scientific. Anti‐PI3K‐p85 (#4292), anti‐Akt (4691S), anti‐p‐Akt (#4060), anti‐AS160 (#2670), anti‐p‐AS160 (#8619) and anti‐GAPDH (#5174) antibodies were obtained from Cell Signaling Biotechnology. Rabbit anti‐GLUT1 (ab115730) and anti‐Cyclin D1 (ab16663) antibodies were purchased from Abcam Biotechnology (Abcam).
+ Open protocol
+ Expand
10

Hispidulin and D-glucose Extraction

Check if the same lab product or an alternative is used in the 5 most similar protocols
Hispidulin (1447-88-7) was purchased from Victory Biological Technology, China and D-glucose (G8270) was from Sigma, USA.
+ Open protocol
+ Expand

About PubCompare

Our mission is to provide scientists with the largest repository of trustworthy protocols and intelligent analytical tools, thereby offering them extensive information to design robust protocols aimed at minimizing the risk of failures.

We believe that the most crucial aspect is to grant scientists access to a wide range of reliable sources and new useful tools that surpass human capabilities.

However, we trust in allowing scientists to determine how to construct their own protocols based on this information, as they are the experts in their field.

Ready to get started?

Sign up for free.
Registration takes 20 seconds.
Available from any computer
No download required

Sign up now

Revolutionizing how scientists
search and build protocols!